Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006662-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006662-M01, RRID:AB_535042
- Product name
- SOX9 monoclonal antibody (M01), clone 2A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SOX9.
- Antigen sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPP
ITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYM
NPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYT
QLTRP- Isotype
- IgG
- Antibody clone number
- 2A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Germ cells influence cord formation and leydig cell gene expression during mouse testis development.
Primary cilia function regulates the length of the embryonic trunk axis and urogenital field in mice.
Rios-Rojas C, Spiller C, Bowles J, Koopman P
Developmental dynamics : an official publication of the American Association of Anatomists 2016 Apr;245(4):433-44
Developmental dynamics : an official publication of the American Association of Anatomists 2016 Apr;245(4):433-44
Primary cilia function regulates the length of the embryonic trunk axis and urogenital field in mice.
Wainwright EN, Svingen T, Ng ET, Wicking C, Koopman P
Developmental biology 2014 Nov 15;395(2):342-54
Developmental biology 2014 Nov 15;395(2):342-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M01), clone 2A2.Lane 1: SOX9 transfected lysate(63.639 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SOX9 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol