HPA003222

PTK7 antibody from Sigma-Aldrich
CCK4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003222
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003222, RRID:AB_1079713
Product name
Anti-PTK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003222
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase-like 7 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVY
WLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTF
QCVARDDVTGEEARSANASFNIKWIEAGPVVLKHP
ASEAEIQPQTQVTLRCHIDGHPRPTYQWFR
Storage
-20C
Provider Type Product Number
- No reagents -