HPA024130

ERC1 antibody from Atlas Antibodies
CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024130, RRID:AB_1856014
Product name
Anti-ERC1
Provider product page
Atlas Antibodies - HPA024130
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKE
AQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQ
TKLETLINQFSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -