Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310964 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLV
DQCWG CSCGDEPGVG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The orphan nuclear receptor DAX-1 acts as a novel transcriptional corepressor of PPARgamma.
Kim GS, Lee GY, Nedumaran B, Park YY, Kim KT, Park SC, Lee YC, Kim JB, Choi HS
Biochemical and biophysical research communications 2008 May 30;370(2):264-8
Biochemical and biophysical research communications 2008 May 30;370(2):264-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting