ABIN487204

PUM3 antibody from antibodies-online
HA-8, hPUF-A, KIAA0020, PEN, Puf-A, PUF6, XTP5

Antibody data

Product number
ABIN487204
Provider
antibodies-online
Product name
anti-KIAA0020 (KIAA0020) (N-Term) antibody
Provider product page
antibodies-online - ABIN487204
Antibody type
Polyclonal
Antigen
The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020
Description
Affinity Purified
Reactivity
Human, Bovine, Canine
Host
Rabbit
Antigen sequence
EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFP
TRKVA KEGGPKVTSR
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -