ABIN487204
antibody from antibodies-online
Targeting: PUM3
HA-8, hPUF-A, KIAA0020, PEN, Puf-A, PUF6, XTP5
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487204 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-KIAA0020 (KIAA0020) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFP
TRKVA KEGGPKVTSR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Role of minor histocompatibility antigens in renal transplantation.
Heinold A, Opelz G, Scherer S, Ruhenstroth A, Laux G, Doehler B, Tran TH
American journal of transplantation : official journal of the American Society of Transplantation and the American Society of Transplant Surgeons 2008 Jan;8(1):95-102
American journal of transplantation : official journal of the American Society of Transplantation and the American Society of Transplant Surgeons 2008 Jan;8(1):95-102
No comments: Submit comment
No validations: Submit validation data