Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1826607 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon, alpha 2 (IFNA2) antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant human interferon alpha 2a produced in non-transgenic plants using a peptide corresponding to AA, HHHHHHCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYL. Percent identity by BLAST analysis: Human (100 %), Chimpanzee, Gorilla, Monkey, Tamarin (92 %), Orangutan, Gibbon, Marmoset (88 %). Immunogen type: Synthetic peptide
- Description
- Protein G purified
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 100 μL
- Storage
- -20°C
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data