Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501643 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 4 (IRF4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the middle region of human IRF4
- Description
- Affinity Purified
- Reactivity
- Human, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISN
PEDYH RSIRHSSIQE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A genome-wide association study identifies novel alleles associated with hair color and skin pigmentation.
Han J, Kraft P, Nan H, Guo Q, Chen C, Qureshi A, Hankinson SE, Hu FB, Duffy DL, Zhao ZZ, Martin NG, Montgomery GW, Hayward NK, Thomas G, Hoover RN, Chanock S, Hunter DJ
PLoS genetics 2008 May 16;4(5):e1000074
PLoS genetics 2008 May 16;4(5):e1000074
No comments: Submit comment
No validations: Submit validation data