HPA005993

UCHL1 antibody from Sigma-Aldrich
PARK5, PGP9.5, Uch-L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005993
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005993, RRID:AB_1858560
Product name
Anti-UCHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005993
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase isozyme L1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLG
FEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAA
HDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDG
RMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEV
RFSAVAL
Storage
-20C
Provider Type Product Number
- No reagents -