HPA003634

ICT1 antibody from Sigma-Aldrich
DS-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003634, RRID:AB_1851388
Product name
Anti-ICT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003634
Antibody type
Polyclonal
Antigen
Immature colon carcinoma transcript 1 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSD
IPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLA
TAEWIAEPVRQKIAITHKNKINRLGELILTSESSR
YQFRNLADCLQKIRDMI
Storage
-20C
Provider Type Product Number
- No reagents -