H00006283-B01

S100A12 antibody from Abnova Corporation
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6

Antibody data

Product number
H00006283-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006283-B01, RRID:AB_1113625
Product name
S100A12 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006283-B01
Antibody type
Polyclonal
Antigen
S100A12 (NP_005612.1, 1 a.a. ~ 92 a.a) full-length human protein.
Description
Mouse polyclonal antibody raised against a full-length human S100A12 protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQ
LLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD
FQEFISLVAIALKAAHYHTHKE
Vial size
50 μL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -