Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503835 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Monoamine Oxidase A (MAOA) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNG
GQERK FVGGSGQVSE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A community-based study of cigarette smoking behavior in relation to variation in three genes involved in dopamine metabolism: Catechol-O-methyltransferase (COMT), dopamine beta-hydroxylase (DBH) and monoamine oxidase-A (MAO-A).
Shiels MS, Huang HY, Hoffman SC, Shugart YY, Bolton JH, Platz EA, Helzlsouer KJ, Alberg AJ
Preventive medicine 2008 Jul;47(1):116-22
Preventive medicine 2008 Jul;47(1):116-22
No comments: Submit comment
No validations: Submit validation data