Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN145697 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Trefoil Factor 1 (TFF1) antibody
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF, corresponding to amino acids 54-84 of Human pS2.
- Description
- Protein G affinity purified
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 0.5 mL
- Concentration
- 0.2 mg/ml
- Storage
- 4°C
No comments: Submit comment
No validations: Submit validation data