Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502678 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Trefoil Factor 1 (TFF1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TFF1 antibody: synthetic peptide directed towards the middle region of human TFF1
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCF
YPNTI DVPPEEECEF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cyclical DNA methylation of a transcriptionally active promoter.
Métivier R, Gallais R, Tiffoche C, Le Péron C, Jurkowska RZ, Carmouche RP, Ibberson D, Barath P, Demay F, Reid G, Benes V, Jeltsch A, Gannon F, Salbert G
Nature 2008 Mar 6;452(7183):45-50
Nature 2008 Mar 6;452(7183):45-50
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting