ABIN608993

antibody from antibodies-online

Targeting: TFF1 BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN608993 - Provider product page
Provider: antibodies-online
Product name: anti-Trefoil Factor 1 (TFF1) (AA 54-84) antibody
Antibody type: Monoclonal
Antigen: Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF, corresponding to amino acids 54-84 of Human pS2. Epitope: Amino acids 54 - 84.
Description: Protein G Column
Reactivity: Human
Host: Mouse
Epitope: AA 54-84
Isotype: IgG
Vial size: 500 μL
Storage: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C
Handling: Avoid repeated freezing and thawing

TFF1 protein structure - ABIN608993 shown in red.