Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN608993 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Trefoil Factor 1 (TFF1) (AA 54-84) antibody
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF, corresponding to amino acids 54-84 of Human pS2. Epitope: Amino acids 54 - 84.
- Description
- Protein G Column
- Reactivity
- Human
- Host
- Mouse
- Epitope
- AA 54-84
- Isotype
- IgG
- Vial size
- 500 μL
- Storage
- May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C
- Handling
- Avoid repeated freezing and thawing
No comments: Submit comment
No validations: Submit validation data