HPA003506

HMGB2 antibody from Sigma-Aldrich
HMG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003506
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003506, RRID:AB_1079070
Product name
Anti-HMGB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003506
Antibody type
Polyclonal
Antigen
High mobility group protein B2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKD
PNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTA
KKLGEMWSEQSAKDKQPYEQKAAKLKEKYE
Storage
-20C
Provider Type Product Number
- No reagents -