Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404852 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Coxsackie Virus and Adenovirus Receptor (CXADR) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CXADR antibody: synthetic peptide directed towards the N terminal of human CXADR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASIN
VTNLQ LSDIGTYQCK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Analysis of the expression of coxsackievirus and adenovirus receptor in five colon cancer cell lines.
Abdolazimi Y, Mojarrad M, Pedram M, Modarressi MH
World journal of gastroenterology : WJG 2007 Dec 21;13(47):6365-9
World journal of gastroenterology : WJG 2007 Dec 21;13(47):6365-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting