HPA003509

UBE2J1 antibody from Sigma-Aldrich
CGI-76, HSPC153, NCUBE1, UBC6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003509
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003509, RRID:AB_1858531
Product name
Anti-NCUBE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003509
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 J1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSG
KTISESDLNHSFSLTDLQDDIPTTFQGATASTSYG
LQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQR
RLSTSPDVIQGHQPRDNHTD
Storage
-20C
Provider Type Product Number
- No reagents -