Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311563 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ankyrin Repeat and SOCS Box Containing 6 (ASB6) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ASB6 antibody: synthetic peptide directed towards the middle region of human ASB6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALH
IAVLR NQPDMVELLV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Asb6, an adipocyte-specific ankyrin and SOCS box protein, interacts with APS to enable recruitment of elongins B and C to the insulin receptor signaling complex.
Wilcox A, Katsanakis KD, Bheda F, Pillay TS
The Journal of biological chemistry 2004 Sep 10;279(37):38881-8
The Journal of biological chemistry 2004 Sep 10;279(37):38881-8
No comments: Submit comment
No validations: Submit validation data