HPA011326

DFNA5 antibody from Sigma-Aldrich
ICERE-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011326
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011326, RRID:AB_1847629
Product name
Anti-DFNA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011326
Antibody type
Polyclonal
Antigen
Non-syndromic hearing impairment protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPR
QQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTA
YFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLR
ALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASAD
ISLERLKSSV
Storage
-20C
Provider Type Product Number
- No reagents -