Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309866 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Small Nuclear RNA Activating Complex, Polypeptide 1, 43kDa (SNAPC1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNAPC1 antibody: synthetic peptide directed towards the C terminal of human SNAPC1
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNI
HKEDK PLSLSMPVIT- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cooperation between small nuclear RNA-activating protein complex (SNAPC) and TATA-box-binding protein antagonizes protein kinase CK2 inhibition of DNA binding by SNAPC.
Gu L, Esselman WJ, Henry RW
The Journal of biological chemistry 2005 Jul 29;280(30):27697-704
The Journal of biological chemistry 2005 Jul 29;280(30):27697-704
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting