H00010462-M02

CLEC10A antibody from Abnova Corporation
CD301, CLECSF13, CLECSF14, HML, HML2

Antibody data

Product number
H00010462-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010462-M02, RRID:AB_1137140
Product name
CLEC10A monoclonal antibody (M02), clone 1E11
Provider product page
Abnova Corporation - H00010462-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CLEC10A.
Antigen sequence
VTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASL
KAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQ
VATLNNNGEEASTEGTCCPVNWVEHQDSCY
Isotype
IgG
Antibody clone number
1E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -