H00007597-M05

ZBTB25 antibody from Abnova Corporation
C14orf51, KUP, ZNF46

Antibody data

Product number
H00007597-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007597-M05, RRID:AB_1205187
Product name
ZBTB25 monoclonal antibody (M05), clone 2B8
Provider product page
Abnova Corporation - H00007597-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZBTB25.
Antigen sequence
DTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLL
EHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWS
DVSLKSSRLSQEHLDLPCALESELTQENVDTILVE
Isotype
IgG
Antibody clone number
2B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -