H00000397-D01P

ARHGDIB antibody from Abnova Corporation
GDIA2, GDID4, Ly-GDI, RAP1GN1, RhoGDI2

Antibody data

Product number
H00000397-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000397-D01P, RRID:AB_1572559
Product name
ARHGDIB purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00000397-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human ARHGDIB protein.
Antigen sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKEL
QEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT
RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGS
EYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT
FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNK
SFFTDDDKQDHLSWEWNLSIKKEWTE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -