Antibody data

Product number
H00056164-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056164-M02, RRID:AB_1581070
Product name
STK31 monoclonal antibody (M02), clone 1C10
Provider product page
Abnova Corporation - H00056164-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STK31.
Antigen sequence
WLSVQNQEFEINKDGIPKVDQFHLDDKVKSLLCSL
ICYRSSMTAEQVLNAECFLMPKEQSVPNPEKDTEY
TLYKKEEEIKTENLDKCMEKTRNGEANFDC
Isotype
IgG
Antibody clone number
1C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -