Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004852-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004852-M03, RRID:AB_1111988
- Product name
- NPY monoclonal antibody (M03), clone 3F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NPY.
- Antigen sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQR
YGKRSSPETLISDLLMRESTENVPRTRLEDPAMW- Isotype
- IgG
- Antibody clone number
- 3F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased interstitial white matter neuron density in the dorsolateral prefrontal cortex of people with schizophrenia.
Yang Y, Fung SJ, Rothwell A, Tianmei S, Weickert CS
Biological psychiatry 2011 Jan 1;69(1):63-70
Biological psychiatry 2011 Jan 1;69(1):63-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NPY is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol