ABIN631827

antibody from antibodies-online

Targeting: ANKLE2 KIAA0692, Lem4, LEMD7

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631827 - Provider product page
Provider: antibodies-online
Product name: anti-Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ANKLE2 protein structure - ABIN631827 shown in red.