Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311402 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDR2 antibody: synthetic peptide directed towards the N terminal of human CDR2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELG
KTLLD RNTELEDSVQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Infection of human B lymphoma cells by Mycoplasma fermentans induces interaction of its elongation factor with the intracytoplasmic domain of Epstein-Barr virus receptor (gp140, EBV/C3dR, CR2, CD21).
Balbo M, Barel M, Lottin-Divoux S, Jean D, Frade R
FEMS microbiology letters 2005 Aug 15;249(2):359-66
FEMS microbiology letters 2005 Aug 15;249(2):359-66
No comments: Submit comment
No validations: Submit validation data