HPA003512

RPLP0 antibody from Sigma-Aldrich
L10E, LP0, P0, PRLP0, RPP0
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003512
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003512, RRID:AB_1079844
Product name
Anti-RPLP0 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003512
Antibody type
Polyclonal
Antigen
60S acidic ribosomal protein P0 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNV
GFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEV
TVPAQNTGLGPEKTSFFQALGIT
Storage
-20C
Provider Type Product Number
- No reagents -