H00007384-D01P

UQCRC1 antibody from Abnova Corporation
D3S3191, QCR1, UQCR1

Antibody data

Product number
H00007384-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007384-D01P, RRID:AB_1716811
Product name
UQCRC1 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00007384-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human UQCRC1 protein.
Antigen sequence
MAASVVCRAATAGAQVLLRARRSPALLRTPALRST
ATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCT
VGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRP
GSALEKEVESMGAHLNAYSTREHTAYYIKALSKDL
PKAVELLGDIVQNCSLEDSQIEKERDVILREMQEN
DASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRK
LSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDL
AQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDD
ALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYD
CTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAE
TGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATE
SEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPA
VAGYGPIEQLPDYNRIRSGMFWLRF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -