ABIN633320

EXOSC7 antibody from antibodies-online
EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p

Antibody data

Product number
ABIN633320
Provider
antibodies-online
Product name
anti-Exosome Component 7 (EXOSC7) (N-Term) antibody
Provider product page
antibodies-online - ABIN633320
Antibody type
Polyclonal
Antigen
EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC
Description
Affinity purified
Reactivity
Human, Mouse
Host
Rabbit
Epitope
N-Term
Vial size (┬Ál)
50 μg
Concentration (mg/ml)
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -