H00079831-M01

KDM8 antibody from Abnova Corporation
FLJ13798, JMJD5
No application information provided.

Antibody data

Product number
H00079831-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079831-M01, RRID:AB_1679466
Product name
JMJD5 monoclonal antibody (M01), clone 1F3
Provider product page
Abnova Corporation - H00079831-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant JMJD5.
Antigen sequence
MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKL
DLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV
ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALC
LCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK
VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLI
PDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG
VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTD
EEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD
QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQG
TISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY
PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCI
LSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Isotype
IgG
Antibody clone number
1F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -