Explore
Validate
Learn
Western blot
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2487948 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 21 Receptor (IL21R) (AA 35-65), (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL21R antibody: synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to AA 35-65 within the N-terminal region of human IL-21R.
- Reactivity
- Human
- Host
- Goat
- Epitope
- AA 35-65,N-Term
- Vial size
- 0.1 mg
- Storage
- Store at -20°C only. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody
- Handling
- Avoid repeat freeze-thaw cycles.Should this product contain a precipitate we recommend microcentrifugation before use.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
