HPA004130

RARS antibody from Atlas Antibodies
DALRD1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004130, RRID:AB_1235409
Product name
Anti-RARS
Provider product page
Atlas Antibodies - HPA004130
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKL
KEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNR
LNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARL
ANIDEEMLQKAARETKILLDHEKEWKLGRCILRFP
EI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -