HPA003979

RARS antibody from Sigma-Aldrich
DALRD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003979, RRID:AB_1856083
Product name
Anti-RARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003979
Antibody type
Polyclonal
Antigen
Arginyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLI
AHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEE
EFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQEL
NKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGF
VQVDDGRKIV
Storage
-20C
Provider Type Product Number
- No reagents -