Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502197 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HAPLN1 antibody: synthetic peptide directed towards the N terminal of human HAPLN1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTA
FGSGI HKIRIKWTKL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression and purification of functionally active hyaluronan-binding domains from human cartilage link protein, aggrecan and versican: formation of ternary complexes with defined hyaluronan oligosaccharides.
Seyfried NT, McVey GF, Almond A, Mahoney DJ, Dudhia J, Day AJ
The Journal of biological chemistry 2005 Feb 18;280(7):5435-48
The Journal of biological chemistry 2005 Feb 18;280(7):5435-48
No comments: Submit comment
No validations: Submit validation data