103-PA04AG
antibody from ReliaTech GmbH
Targeting: PGF
D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 103-PA04AG - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- PlGF
- Antibody type
- Polyclonal
- Description
- antibody Protein-A purified from serum
- Reactivity
- Mouse
- Host
- Rabbit
- Antigen sequence
ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYIL
DEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPI
KTANITMQILKIPPNRDPHFYVEMTFSQDVLCECR
PILETTKAERRKTKGKRKRSRNSQTEEPHP- Antibody clone number
- Rabbit IG
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunohistochemical staining of PlGF in paraffin-embedded mouse placenta embryo (a and b) showing intense cytoplasmic staining in mouse placenta at E9. In the embryo a positive signal was observed in endothelial structures of highly vascularized organs. Cross-reactivity of antibody was disproved as staining of human placenta did not reveal any signal ©. Lower panel shows higher magnification of boxes in a-c. The experiments were performed by Dr. Frank Bicker from the research group „Molecular Signal Transduction“ (Prof. Dr. Mirko HH Schmidt), Institute of Microscopic Anatomy and Neurobiology, University Medical Center of Johannes Gutenberg University Mainz, Germany.