HPA021579

SCO1 antibody from Sigma-Aldrich
SCOD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021579
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021579, RRID:AB_1856632
Product name
Anti-SCO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021579
Antibody type
Polyclonal
Antigen
Protein SCO1 homolog, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISI
DPERDTKEAIANYVKEFSPKLVGLTG
Storage
-20C
Provider Type Product Number
- No reagents -