HPA023489

HRSP12 antibody from Sigma-Aldrich
P14.5, PSP, UK114
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023489
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023489, RRID:AB_1858252
Product name
Anti-HRSP12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023489
Antibody type
Polyclonal
Antigen
Ribonuclease UK114 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNF
PARAAYQVAALPKGSRIEIEAVAIQGP
Storage
-20C
Provider Type Product Number
- No reagents -