Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309993 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ets Homologous Factor (EHF) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-Ehf antibody: synthetic peptide directed towards the N terminal of mouse Ehf
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLY
SNLQH LKWNGQCSSD- Vial size
- 50 µg
Submitted references Profile of Ets gene expression in human breast carcinoma.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
He J, Pan Y, Hu J, Albarracin C, Wu Y, Dai JL
Cancer biology & therapy 2007 Jan;6(1):76-82
Cancer biology & therapy 2007 Jan;6(1):76-82
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, Kitchen JR, Wang X, Threat TA, Wang X, Hasegawa A, Sun T, Grahovac MJ, Kargul GJ, Lim MK, Cui Y, Sano Y, Tanaka T, Liang Y, Mason S, Paonessa PD, Sauls AD, DePalma GE, Sharara R, Rowe LB, Eppig J, Morrell C, Doi H
Development (Cambridge, England) 2000 Apr;127(8):1737-49
Development (Cambridge, England) 2000 Apr;127(8):1737-49
No comments: Submit comment
No validations: Submit validation data