Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027067-M14 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027067-M14, RRID:AB_894276
- Product name
- STAU2 monoclonal antibody (M14), clone 3B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant STAU2.
- Antigen sequence
LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNN
TPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPK
DMNQPSSSFFSISPTSNSSATIARELLMNG- Isotype
- IgG
- Antibody clone number
- 3B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7.Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell . [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol