H00003305-B01P

HSPA1L antibody from Abnova Corporation
HSP70-HOM, hum70t

Antibody data

Product number
H00003305-B01P
Provider
Abnova Corporation
Product name
HSPA1L purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00003305-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HSPA1L protein.
Antigen sequence
MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQ
GNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVF
DAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKV
LVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHP
VTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRII
NEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVS
ILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVE
EFKRKHKKDISQNKRAVRRLRTACERAKRTLSSST
QANLEIDSLYEGIDFYTSITRARFEELCADLFRGT
LEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQR
LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGD
KSEKVQDLLLLDVAPLSLGLETAGGVMTALMKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDN
NLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNV
TAMDKSTGKVNKITIANDKGRLSKEEIERMVLDAE
KYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGL
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFD
HKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGR
PATGPTIEEVD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -