Antibody data

Product number
H00005017-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005017-M01, RRID:AB_1578324
Product name
OVOL1 monoclonal antibody (M01), clone 1B3
Provider product page
Abnova Corporation - H00005017-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant OVOL1.
Antigen sequence
MPRAFLVKKPCVSTCKRNWSELPDEGRGEIYVPVS
LGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSY
SMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRAKM
KVTLGDSPSGDLFTCRVCQRAFTYQRMLNRHMKCH
NDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYK
CSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRA
KLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKT
SKKVAVALQNTVTSLLQGSPHL
Isotype
IgG
Antibody clone number
1B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -