ABIN630395

antibody from antibodies-online

Targeting: SLC13A3 NADC3, SDCT2

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630395 - Provider product page
Provider: antibodies-online
Product name: anti-Solute Carrier Family 13 Member 3 (SLC13A3) antibody
Antibody type: Polyclonal
Antigen: SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SLC13A3 protein structure - ABIN630395 shown in red.