ABIN630296

antibody from antibodies-online

Targeting: SLC35C1 FLJ11320, FUCT1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630296 - Provider product page
Provider: antibodies-online
Product name: anti-Solute Carrier Family 35, Member C1 (SLC35C1) (N-Term) antibody
Antibody type: Polyclonal
Antigen: SLC35 C1 antibody was raised using the N terminal of SLC35 1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

SLC35C1 protein structure - ABIN630296 shown in red.