Antibody data

Product number
H00006374-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006374-M05A, RRID:AB_1574171
Product name
CXCL5 monoclonal antibody (M05A), clone 2A9
Provider product page
Abnova Corporation - H00006374-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CXCL5.
Antigen sequence
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIA
SAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
IGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQK
ILDGGNKEN
Isotype
IgG
Antibody clone number
2A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -