H00006642-M02

SNX1 antibody from Abnova Corporation
HsT17379, MGC8664, SNX1A, Vps5

Antibody data

Product number
H00006642-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006642-M02, RRID:AB_1112143
Product name
SNX1 monoclonal antibody (M02), clone 1E3
Provider product page
Abnova Corporation - H00006642-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SNX1.
Antigen sequence
KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEK
HSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFL
EKRRAALERYLQRIVNHPTMLQDPDVREFLEKEEL
PRAVG
Isotype
IgG
Antibody clone number
1E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -