ABIN971747

SNX1 antibody from antibodies-online
HsT17379, MGC8664, SNX1A, Vps5

Antibody data

Product number
ABIN971747
Provider
antibodies-online
Product name
anti-Sorting Nexin 1 (SNX1) (N-Term) antibody
Provider product page
antibodies-online - ABIN971747
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
EDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIH
EEQDQ EPQDLFADAT
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -