Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184004 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ribonuclease H2, Subunit A (RNASEH2A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the middle region of human RNASEH2A
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNE
GSQAR PRSSHRYFLE- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cloning of the cDNA encoding the large subunit of human RNase HI, a homologue of the prokaryotic RNase HII.
Frank P, Braunshofer-Reiter C, Wintersberger U, Grimm R, Büsen W
Proceedings of the National Academy of Sciences of the United States of America 1998 Oct 27;95(22):12872-7
Proceedings of the National Academy of Sciences of the United States of America 1998 Oct 27;95(22):12872-7
No comments: Submit comment
No validations: Submit validation data