HPA018209

CSNK1G1 antibody from Sigma-Aldrich
CK1gamma1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018209
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018209, RRID:AB_1847278
Product name
Anti-CSNK1G1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018209
Antibody type
Polyclonal
Antigen
Casein kinase I isoform gamma-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTF
DYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHR
DRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPI
TAHAEVEVVEEAKCCCFFKRKRKKTA
Storage
-20C
Provider Type Product Number
- No reagents -