Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501211 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kinesin Heavy Chain Member 2A (KIF2A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the middle region of human KIF2A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DSYATQLEAILEQKIDILTELRDKVKSFRAALQEE
EQASK QINPKRPRAL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references DDA3 recruits microtubule depolymerase Kif2a to spindle poles and controls spindle dynamics and mitotic chromosome movement.
Jang CY, Wong J, Coppinger JA, Seki A, Yates JR 3rd, Fang G
The Journal of cell biology 2008 Apr 21;181(2):255-67
The Journal of cell biology 2008 Apr 21;181(2):255-67
No comments: Submit comment
No validations: Submit validation data